Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 30 (TVB30)

This Recombinant Human T cell receptor beta variable 30 (TVB30) spans the amino acid sequence from region 19-111. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 30 TRBV30

UniProt

A0A0K0K1B3

Expression Region

19-111

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QTIHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGLQLLFYSVGIGQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human LETM2 Protein - (Dry Ice)
H00137994-P01-10ug 10 µg

Recombinant Human LETM2 Protein - (Dry Ice)

Sign In for Pricing
View Details
Human Urethral FibrOut™: Fibroblast Inhibitory System (for 500 mL medium)
7-15102 1 Kit

Human Urethral FibrOut™: Fibroblast Inhibitory System (for 500 mL medium)

Sign In for Pricing
View Details
TRIM49B Double Nickase Plasmid (h2)
sc-416589-NIC-2 20 µg

TRIM49B Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Biotin Linked Monoclonal Antibody to Visfatin (VF)
MBS2130603-01 0.1 mL

Biotin Linked Monoclonal Antibody to Visfatin (VF)

Sign In for Pricing
View Details
Biotin Linked Monoclonal Antibody to Visfatin (VF)
MBS2130603-02 0.2 mL

Biotin Linked Monoclonal Antibody to Visfatin (VF)

Sign In for Pricing
View Details
Biotin Linked Monoclonal Antibody to Visfatin (VF)
MBS2130603-03 0.5 mL

Biotin Linked Monoclonal Antibody to Visfatin (VF)

Sign In for Pricing
View Details