Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 30 (TVB30)

This Recombinant Human T cell receptor beta variable 30 (TVB30) spans the amino acid sequence from region 19-111. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 30 TRBV30

UniProt

A0A0K0K1B3

Expression Region

19-111

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QTIHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGLQLLFYSVGIGQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pdzd11 Mouse siRNA Oligo Duplex (Locus ID 72621)
SR402644 1 Kit

Pdzd11 Mouse siRNA Oligo Duplex (Locus ID 72621)

Sign In for Pricing
View Details
BNF-Starch-far redF NH2
164-01-102 5 mL

BNF-Starch-far redF NH2

Sign In for Pricing
View Details
Zfp236 ORF Vector (Mouse) (pORF)
ORF062266 1.0 µg DNA

Zfp236 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Kcna5 AAV siRNA Pooled Vector
25329166 1.0 µg

Kcna5 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Human SRGAP1 Pre-designed siRNA Set B
SI015769B 1 Each

Human SRGAP1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
MEF2A/MEF2C Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-62907R-BF488-01 20 µL

MEF2A/MEF2C Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details