Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 27 (TVB27)

This Recombinant Human T cell receptor beta variable 27 (TVB27) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 27 TRBV27

UniProt

A0A0K0K1C4

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVTQNPRYLITVTGKKLTVTCSQNMNHEYMSWYRQDPGLGLRQIYYSMNVEVTDKGDVPEGYKVSRKEKRNFPLILESPSPNQTSLYFCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tabalumab Biosimilar - Research Grade
ICH5103-10mg 10 mg (2x 5 mg)

Tabalumab Biosimilar - Research Grade

Sign In for Pricing
View Details
UCK2 (NM_012474) Human Over-expression Lysate
LY402221 100 µg

UCK2 (NM_012474) Human Over-expression Lysate

Sign In for Pricing
View Details
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/2210R), CF647 conjugate, 0.1mg/mL
BNC472210-500 1x 500 µL

Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/2210R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Testis
CR562835 5 µg

Tissue Total RNA, Testis

Sign In for Pricing
View Details
N-(1,3,4-Thiadiazolyl)nicotinamide
TRC-T344000-25MG 25 mg

N-(1,3,4-Thiadiazolyl)nicotinamide

Sign In for Pricing
View Details
Human REG3γ (Regenerating Islet Derived Protein 3 Gamma) CLIA Kit
E-CL-H0839-01 24 Tests

Human REG3γ (Regenerating Islet Derived Protein 3 Gamma) CLIA Kit

Sign In for Pricing
View Details