Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-1 (TVB61)

This Recombinant Human T cell receptor beta variable 6-1 (TVB61) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-1 TRBV6-1

UniProt

A0A0K0K1D8

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSASEGTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD56 / NCAM (NCAM1/784), 1mg/mL
BNUM0784-50 1x 50 µL

CD56 / NCAM (NCAM1/784), 1mg/mL

Sign In for Pricing
View Details
SDHD (N-term) Rabbit Polyclonal Antibody
AP53823PU-N 400 µL

SDHD (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bio Bucket™
B8300 1 Each

Bio Bucket™

Sign In for Pricing
View Details
Meclocycline
TRC-M202723-2.5MG 2.5 mg

Meclocycline

Sign In for Pricing
View Details
CCDC43 Antibody
KC-42846-01 50 μL

CCDC43 Antibody

Sign In for Pricing
View Details
CCDC43 Antibody
KC-42846-02 100 µL

CCDC43 Antibody

Sign In for Pricing
View Details