Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-1 (TVB61)

This Recombinant Human T cell receptor beta variable 6-1 (TVB61) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-1 TRBV6-1

UniProt

A0A0K0K1D8

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSASEGTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Desmoglein-3 (Squamous Cell Marker) (DSG3/2840), CF568 conjugate, 0.1mg/mL
BNC682840-500 1x 500 µL

Desmoglein-3 (Squamous Cell Marker) (DSG3/2840), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PP11 (ENDOU) (NM_001172439) Human Over-expression Lysate
LY433028 100 µg

PP11 (ENDOU) (NM_001172439) Human Over-expression Lysate

Sign In for Pricing
View Details
Teduglutide Trifluoroacetic Acid Salt
TRC-T138000-5MG 5 mg

Teduglutide Trifluoroacetic Acid Salt

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung: right upper lobe
CS640605 5x 5 µm

Frozen Tissue Sections, Lung: right upper lobe

Sign In for Pricing
View Details
Odronextamab Biosimilar - Research Grade
ICH5027-5mg 5 mg

Odronextamab Biosimilar - Research Grade

Sign In for Pricing
View Details
SDHAF1 Mouse Monoclonal Antibody [Clone ID: OTI5D4]
CF809735 100 µg

SDHAF1 Mouse Monoclonal Antibody [Clone ID: OTI5D4]

Sign In for Pricing
View Details