Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 10-3 (TVBJ3)

This Recombinant Human T cell receptor beta variable 10-3 (TVBJ3) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 10-3 TRBV10-3

UniProt

A0A0K0K1G6

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GITQSPRHKVTETGTPVTLRCHQTENHRYMYWYRQDPGHGLRLIHYSYGVKDTDKGEVSDGYSVSRSKTEDFLLTLESATSSQTSVYFCAISE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rhodamine 101 Chloride Salt *CAS 64339-18-0*
75-AAT 25 mg

Rhodamine 101 Chloride Salt *CAS 64339-18-0*

Sign In for Pricing
View Details
SENP2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H1]
TA504870AM 100 µL

SENP2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H1]

Sign In for Pricing
View Details
COP1 (RFWD2) (NM_001001740) Human Over-expression Lysate
LY424225 100 µg

COP1 (RFWD2) (NM_001001740) Human Over-expression Lysate

Sign In for Pricing
View Details
Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2925), CF405S conjugate, 0.1mg/mL
BNC042925-500 1x 500 µL

Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2925), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
General Bovine Serum Albumin (BSA) ELISA Kit
RD-BSA-Ge-01 96 Tests

General Bovine Serum Albumin (BSA) ELISA Kit

Sign In for Pricing
View Details
General Bovine Serum Albumin (BSA) ELISA Kit
RD-BSA-Ge-02 48 Tests

General Bovine Serum Albumin (BSA) ELISA Kit

Sign In for Pricing
View Details