Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 10-3 (TVBJ3)

This Recombinant Human T cell receptor beta variable 10-3 (TVBJ3) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 10-3 TRBV10-3

UniProt

A0A0K0K1G6

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GITQSPRHKVTETGTPVTLRCHQTENHRYMYWYRQDPGHGLRLIHYSYGVKDTDKGEVSDGYSVSRSKTEDFLLTLESATSSQTSVYFCAISE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Buccutite™ Rapid APC-iFluor® 700 Tandem Antibody Labeling Kit *Production Scale Optimized for Labeling 1 mg Antibody Per Reaction*
5413-AAT 2 Labelings

Buccutite™ Rapid APC-iFluor® 700 Tandem Antibody Labeling Kit *Production Scale Optimized for Labeling 1 mg Antibody Per Reaction*

Sign In for Pricing
View Details
USP10 Human Gene Knockout Kit (CRISPR)
KN400835 1 Kit

USP10 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human USH2A activation kit by CRISPRa
GA105097 1 Kit

Human USH2A activation kit by CRISPRa

Sign In for Pricing
View Details
4-Pentylbromobenzene
TRC-P279790-5G 5 g

4-Pentylbromobenzene

Sign In for Pricing
View Details
HGS Rabbit Polyclonal Antibody
TA384407 100 µL

HGS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DRGX Mouse Monoclonal Antibody [Clone ID: OTI2C11]
CF813114 100 µg

DRGX Mouse Monoclonal Antibody [Clone ID: OTI2C11]

Sign In for Pricing
View Details