Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 10-3 (TVBJ3)

This Recombinant Human T cell receptor beta variable 10-3 (TVBJ3) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 10-3 TRBV10-3

UniProt

A0A0K0K1G6

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GITQSPRHKVTETGTPVTLRCHQTENHRYMYWYRQDPGHGLRLIHYSYGVKDTDKGEVSDGYSVSRSKTEDFLLTLESATSSQTSVYFCAISE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

β-Amyloid (1-39) (D5Y9L) Rabbit Monoclonal Antibody
CST 12077T 20 µL

β-Amyloid (1-39) (D5Y9L) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
PON2 Recombinant Rabbit mAb
E43S47088 100 µL

PON2 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Methyl Thymol Blue Complexone Indicator For Complexometric titration
1131050 5 5 g

Methyl Thymol Blue Complexone Indicator For Complexometric titration

Sign In for Pricing
View Details
DDDDK-tag Antibody [M2.1], Rabbit IgG
24-504 0.2 mg

DDDDK-tag Antibody [M2.1], Rabbit IgG

Sign In for Pricing
View Details
Human Progesterone induced blocking factor (PIBF) ELISA Kit
CK-bio-13025-01 48 Tests

Human Progesterone induced blocking factor (PIBF) ELISA Kit

Sign In for Pricing
View Details
Human Progesterone induced blocking factor (PIBF) ELISA Kit
CK-bio-13025-02 96 Tests

Human Progesterone induced blocking factor (PIBF) ELISA Kit

Sign In for Pricing
View Details