Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial sheath formation-associated protein (MISFA), partial

This Recombinant Human Mitochondrial sheath formation-associated protein (MISFA), partial spans the amino acid sequence from region 24-59. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mitochondrial sheath formation-associated protein; Putative transmembrane protein SPTY2D1OS; SPTY2D1 antisense RNA 1; SPTY2D1 opposite strand; MISFA SPTY2D1-AS1 SPTY2D1OS

UniProt

A0A0U1RRN3

Expression Region

24-59

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PPTLKWQERWPVQESKTQLRRRALGEDLLQNHVEGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calpain 6 HDR Plasmid (m)
sc-419444-HDR 20 µg

Calpain 6 HDR Plasmid (m)

Sign In for Pricing
View Details
CLSTN1 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-62063R-BF750-01 20 µL

CLSTN1 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
CLSTN1 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-62063R-BF750-02 100 µL

CLSTN1 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
TRIM54 (N-Term) Rabbit pAb
MBS8551962-01 0.1 mL

TRIM54 (N-Term) Rabbit pAb

Sign In for Pricing
View Details
TRIM54 (N-Term) Rabbit pAb
MBS8551962-02 0.1 mL (AF405L)

TRIM54 (N-Term) Rabbit pAb

Sign In for Pricing
View Details
TRIM54 (N-Term) Rabbit pAb
MBS8551962-03 0.1 mL (AF405S)

TRIM54 (N-Term) Rabbit pAb

Sign In for Pricing
View Details