Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial sheath formation-associated protein (MISFA), partial

This Recombinant Human Mitochondrial sheath formation-associated protein (MISFA), partial spans the amino acid sequence from region 24-59. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mitochondrial sheath formation-associated protein; Putative transmembrane protein SPTY2D1OS; SPTY2D1 antisense RNA 1; SPTY2D1 opposite strand; MISFA SPTY2D1-AS1 SPTY2D1OS

UniProt

A0A0U1RRN3

Expression Region

24-59

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PPTLKWQERWPVQESKTQLRRRALGEDLLQNHVEGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Heme oxygenase 2 ELISA Kit
EK1994 Inquire

Mouse Heme oxygenase 2 ELISA Kit

Sign In for Pricing
View Details
SMtCK (h) -PR
sc-38969-PR 10 µM - 20 µL

SMtCK (h) -PR

Sign In for Pricing
View Details
GNG10 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV626482 1.0 µg DNA

GNG10 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Anti-PEX1 Antibody Picoband® Fluoro647 Conjugated
A03025-1-Fluoro647 100 µg/Vial

Anti-PEX1 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Human ING3 Recombinant Protein
PPT-13412 100 µg

Human ING3 Recombinant Protein

Sign In for Pricing
View Details
APC Linked Monoclonal Antibody to 2',5'Oligoadenylate Synthetase 1 (OAS1)
MBS2135334-01 0.1 mL

APC Linked Monoclonal Antibody to 2',5'Oligoadenylate Synthetase 1 (OAS1)

Sign In for Pricing
View Details