Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-4 (TVB64)

This Recombinant Human T cell receptor beta variable 6-4 (TVB64) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-4 TRBV6-4

UniProt

A0A1B0GX49

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GITQAPTSQILAAGRSMTLRCTQDMRHNAMYWYRQDLGLGLRLIHYSNTAGTTGKGEVPDGYSVSRANTDDFPLTLASAVPSQTSVYFCASSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FPR1 Peptide
DF4881-BP 1 mg

FPR1 Peptide

Sign In for Pricing
View Details
SERPINH1 Protein Vector (Mouse) (pPM-C-HA)
PV228260 500 ng

SERPINH1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Goat Platelet Membrane Glycoprotein IV ELISA kit
GTR10376280 96 Well

Goat Platelet Membrane Glycoprotein IV ELISA kit

Sign In for Pricing
View Details
1-Azaspiro[4.5]decan-4-ol
HMC01704-01 50 mg

1-Azaspiro[4.5]decan-4-ol

Sign In for Pricing
View Details
1-Azaspiro[4.5]decan-4-ol
HMC01704-02 0.5 g

1-Azaspiro[4.5]decan-4-ol

Sign In for Pricing
View Details
Recombinant Clostridium Thermocellum recF Protein (aa 1-369)
VAng-Lsx02036-1mgEcoli 1 mg (E. coli)

Recombinant Clostridium Thermocellum recF Protein (aa 1-369)

Sign In for Pricing
View Details