Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-4 (TVB64)

This Recombinant Human T cell receptor beta variable 6-4 (TVB64) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-4 TRBV6-4

UniProt

A0A1B0GX49

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GITQAPTSQILAAGRSMTLRCTQDMRHNAMYWYRQDLGLGLRLIHYSNTAGTTGKGEVPDGYSVSRANTDDFPLTLASAVPSQTSVYFCASSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-KLF5 (Ser272) Antibody Blocking Peptide
orb72907 500 µg

Phospho-KLF5 (Ser272) Antibody Blocking Peptide

Sign In for Pricing
View Details
Mouse Anti-Human CD66b mAb (FITC) [G10F5]
E2782885 100 Tests

Mouse Anti-Human CD66b mAb (FITC) [G10F5]

Sign In for Pricing
View Details
Dematin (Ab-403) Antibody
MBS859701-01 0.1 mg

Dematin (Ab-403) Antibody

Sign In for Pricing
View Details
Dematin (Ab-403) Antibody
MBS859701-02 0.1 mL (AF635)

Dematin (Ab-403) Antibody

Sign In for Pricing
View Details
Dematin (Ab-403) Antibody
MBS859701-03 0.1 mL (AF610)

Dematin (Ab-403) Antibody

Sign In for Pricing
View Details
Dematin (Ab-403) Antibody
MBS859701-04 0.1 mL (AF405S)

Dematin (Ab-403) Antibody

Sign In for Pricing
View Details