Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-4 (TVB64)

This Recombinant Human T cell receptor beta variable 6-4 (TVB64) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-4 TRBV6-4

UniProt

A0A1B0GX49

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GITQAPTSQILAAGRSMTLRCTQDMRHNAMYWYRQDLGLGLRLIHYSNTAGTTGKGEVPDGYSVSRANTDDFPLTLASAVPSQTSVYFCASSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NQO1, Active
enz-1107 1µg

NQO1, Active

Sign In for Pricing
View Details
PAQR6 Peptide - middle region
orb2014486 100 µg

PAQR6 Peptide - middle region

Sign In for Pricing
View Details
ACAP2 antibody
70R-15532 50 ul

ACAP2 antibody

Sign In for Pricing
View Details
Nrd1 3'UTR GFP Stable Cell Line
TU164317 1.0 mL

Nrd1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
REG1 alpha (REG1A) Mouse Monoclonal Antibody [Clone:3E8]
E45M21369 100 µg

REG1 alpha (REG1A) Mouse Monoclonal Antibody [Clone:3E8]

Sign In for Pricing
View Details
Angptl3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3520008 1.0 µg DNA

Angptl3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details