Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-8 (TVB78)

This Recombinant Human T cell receptor beta variable 7-8 (TVB78) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-8 TRBV7-8

UniProt

A0A1B0GX51

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPRYKVAKRGQDVALRCDPISGHVSLFWYQQALGQGPEFLTYFQNEAQLDKSGLPSDRFFAERPEGSVSTLKIQRTQQEDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cnot9 (NM_001009357) Rat Tagged Lenti ORF Clone
RR208221L3 10 µg

Cnot9 (NM_001009357) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Vistusertib (AZD2014)
C08855-10mM/1mL 10 mM/1mL

Vistusertib (AZD2014)

Sign In for Pricing
View Details
Olr1683 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
34135156 3x 1.0 µg DNA

Olr1683 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
ELISA kit for Rat Cytochrome P450 2U1 (CYP2U1)
KTE100805-01 48 Tests

ELISA kit for Rat Cytochrome P450 2U1 (CYP2U1)

Sign In for Pricing
View Details
ELISA kit for Rat Cytochrome P450 2U1 (CYP2U1)
KTE100805-02 96 Tests

ELISA kit for Rat Cytochrome P450 2U1 (CYP2U1)

Sign In for Pricing
View Details
ELISA kit for Rat Cytochrome P450 2U1 (CYP2U1)
KTE100805-03 5x 96 Well

ELISA kit for Rat Cytochrome P450 2U1 (CYP2U1)

Sign In for Pricing
View Details