Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-8 (TVB78)

This Recombinant Human T cell receptor beta variable 7-8 (TVB78) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-8 TRBV7-8

UniProt

A0A1B0GX51

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPRYKVAKRGQDVALRCDPISGHVSLFWYQQALGQGPEFLTYFQNEAQLDKSGLPSDRFFAERPEGSVSTLKIQRTQQEDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM141 Double Nickase Plasmid (m)
sc-424566-NIC 20 µg

TMEM141 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Rabbit IFN beta Recombinant Protein
RP1396U-01 5 µg

Rabbit IFN beta Recombinant Protein

Sign In for Pricing
View Details
Rabbit IFN beta Recombinant Protein
RP1396U-02 25 µg

Rabbit IFN beta Recombinant Protein

Sign In for Pricing
View Details
THT-251-7425-2-SC Pre-sized Labels for Printers
121019 2000 Roll (2000 Lots x 1 Roll)

THT-251-7425-2-SC Pre-sized Labels for Printers

Sign In for Pricing
View Details
Sprn sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4379908 1.0 µg DNA

Sprn sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
6-Ethoxynicotinaldehyde
275764-01 250 mg

6-Ethoxynicotinaldehyde

Sign In for Pricing
View Details