Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor delta variable 1 (TRDV1)

This Recombinant Human T cell receptor delta variable 1 (TRDV1) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor delta variable 1 TRDV1

UniProt

A0A1B0GX56

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ror1 Pre-designed siRNA Set A
SI112163A 1 Each

Mouse Ror1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
M- ((3-Chloro-4- (3- (2,4,6-triamino-5-pyrimidinyl) propoxy) phenyl) carbamoyl) benzenesulfonyl fluoride monoethanesulfonate
orb1985753-01 100 mg

M- ((3-Chloro-4- (3- (2,4,6-triamino-5-pyrimidinyl) propoxy) phenyl) carbamoyl) benzenesulfonyl fluoride monoethanesulfonate

Sign In for Pricing
View Details
M- ((3-Chloro-4- (3- (2,4,6-triamino-5-pyrimidinyl) propoxy) phenyl) carbamoyl) benzenesulfonyl fluoride monoethanesulfonate
orb1985753-02 500 mg

M- ((3-Chloro-4- (3- (2,4,6-triamino-5-pyrimidinyl) propoxy) phenyl) carbamoyl) benzenesulfonyl fluoride monoethanesulfonate

Sign In for Pricing
View Details
Multiplex Assay Kit for Glycine-N-Methyltransferase (GNMT), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0031089 96 Tests

Multiplex Assay Kit for Glycine-N-Methyltransferase (GNMT), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
Phospho-KLF5 (Ser311) Polyclonal Antibody, APC Conjugated
bs-2303R-APC 100 µL

Phospho-KLF5 (Ser311) Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Recombinant Invertebrate iridescent virus 6 Putative tyrosine phosphatase 197R (IIV6-197R)
MBS1323995-01 0.02 mg (E-Coli)

Recombinant Invertebrate iridescent virus 6 Putative tyrosine phosphatase 197R (IIV6-197R)

Sign In for Pricing
View Details