Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor delta variable 1 (TRDV1)

This Recombinant Human T cell receptor delta variable 1 (TRDV1) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor delta variable 1 TRDV1

UniProt

A0A1B0GX56

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hlx ORF Vector (Rat) (pORF)
23473016 1.0 µg DNA

Hlx ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
LAG3 Protein Vector (Mouse) (pPB-N-His)
PV195695 500 ng

LAG3 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
3-O-α-L-Fucopyranosyl-D-glucose
GC0399-10mg 10 mg

3-O-α-L-Fucopyranosyl-D-glucose

Sign In for Pricing
View Details
CD40LG ELISA Kit (Rat) (OKAN05964)
OKAN05964 96 Well

CD40LG ELISA Kit (Rat) (OKAN05964)

Sign In for Pricing
View Details
SOX4 Antibody
ABD2610 100 µg

SOX4 Antibody

Sign In for Pricing
View Details
SNRPN (NM_022805) Human Over-expression Lysate
LC411550 20 µg

SNRPN (NM_022805) Human Over-expression Lysate

Sign In for Pricing
View Details