Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor delta variable 1 (TRDV1)

This Recombinant Human T cell receptor delta variable 1 (TRDV1) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor delta variable 1 TRDV1

UniProt

A0A1B0GX56

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGPS Knockout K562 Polyclonal Cells
ARG20039 1 Million

AGPS Knockout K562 Polyclonal Cells

Sign In for Pricing
View Details
Mouse Anti-Human Galectin-3 Monoclonal Antibody
MA88251HU-01 50 µg

Mouse Anti-Human Galectin-3 Monoclonal Antibody

Sign In for Pricing
View Details
Mouse Anti-Human Galectin-3 Monoclonal Antibody
MA88251HU-02 100 µg

Mouse Anti-Human Galectin-3 Monoclonal Antibody

Sign In for Pricing
View Details
Mouse Anti-Human Galectin-3 Monoclonal Antibody
MA88251HU-03 500 µg

Mouse Anti-Human Galectin-3 Monoclonal Antibody

Sign In for Pricing
View Details
Mouse Anti-Human Galectin-3 Monoclonal Antibody
MA88251HU-04 1 mg

Mouse Anti-Human Galectin-3 Monoclonal Antibody

Sign In for Pricing
View Details
AFViolet 450 Anti-Mouse CD90.2 Antibody
RD30228F-01 50 Tests

AFViolet 450 Anti-Mouse CD90.2 Antibody

Sign In for Pricing
View Details