Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 2 (TVB2)

This Recombinant Human T cell receptor beta variable 2 (TVB2) spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 2 TRBV2

UniProt

A0A1B0GX68

Expression Region

20-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EPEVTQTPSHQVTQMGQEVILRCVPISNHLYFYWYRQILGQKVEFLVSFYNNEISEKSEIFDDQFSVERPDGSNFTLKIRSTKLEDSAMYFCASSE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF131 Double Nickase Plasmid (h)
sc-406166-NIC 20 µg

ZNF131 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
3- (1H-Pyrrol-1-yl) aniline
OR938968-01 250 mg

3- (1H-Pyrrol-1-yl) aniline

Sign In for Pricing
View Details
3- (1H-Pyrrol-1-yl) aniline
OR938968-02 1 g

3- (1H-Pyrrol-1-yl) aniline

Sign In for Pricing
View Details
Human Transmembrane protein 43 (TMEM43) ELISA Kit
abx550509 96 Tests

Human Transmembrane protein 43 (TMEM43) ELISA Kit

Sign In for Pricing
View Details
SAP 30BP HDR Plasmid (m)
sc-425340-HDR 20 µg

SAP 30BP HDR Plasmid (m)

Sign In for Pricing
View Details
PECMV-Itgb1-m-FLAG
BZ16259 1 Vial

PECMV-Itgb1-m-FLAG

Sign In for Pricing
View Details