Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 12-5 (TVBL5)

This Recombinant Human T cell receptor beta variable 12-5 (TVBL5) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 12-5 TRBV12-5

UniProt

A0A1B0GX78

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RVTQTPRHKVTEMGQEVTMRCQPILGHNTVFWYRQTMMQGLELLAYFRNRAPLDDSGMPKDRFSAEMPDATLATLKIQPSEPRDSAVYFCASGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MARK4 Antibody
E18-0693-2 100 µg -100 µL

MARK4 Antibody

Sign In for Pricing
View Details
1.5 mL, Sharp-bottomed, with loose Cap, Hinged Thread Cap with Sealing Ring, Red Cap, Sterile, Bag Package, 50 pcs/pack, 10 packs/box, 4 boxes/case, 2000 pcs/case
634113R 2000 PCS/CS

1.5 mL, Sharp-bottomed, with loose Cap, Hinged Thread Cap with Sealing Ring, Red Cap, Sterile, Bag Package, 50 pcs/pack, 10 packs/box, 4 boxes/case, 2000 pcs/case

Sign In for Pricing
View Details
Elovl2 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6346902 1.0 µg DNA

Elovl2 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
βB2-crystallin shRNA (h) Lentiviral Particles
sc-40444-V 200 µL

βB2-crystallin shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
ANKRD49 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
12007124 3x 1.0µg DNA

ANKRD49 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Streptolysin O Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-41190R-BF750 100 µL

Streptolysin O Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details