Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 12-5 (TVBL5)

This Recombinant Human T cell receptor beta variable 12-5 (TVBL5) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 12-5 TRBV12-5

UniProt

A0A1B0GX78

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RVTQTPRHKVTEMGQEVTMRCQPILGHNTVFWYRQTMMQGLELLAYFRNRAPLDDSGMPKDRFSAEMPDATLATLKIQPSEPRDSAVYFCASGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bi-Phospho-JNK1 (T183/Y185) Antibody
MBS9202822-01 0.08 mL

Bi-Phospho-JNK1 (T183/Y185) Antibody

Sign In for Pricing
View Details
Bi-Phospho-JNK1 (T183/Y185) Antibody
MBS9202822-02 0.4 mL

Bi-Phospho-JNK1 (T183/Y185) Antibody

Sign In for Pricing
View Details
Bi-Phospho-JNK1 (T183/Y185) Antibody
MBS9202822-03 5x 0.4 mL

Bi-Phospho-JNK1 (T183/Y185) Antibody

Sign In for Pricing
View Details
Gboxin
BA6555-5.1 1 mL (10 mM in DMSO)

Gboxin

Sign In for Pricing
View Details
P53 BP3 Polyclonal Antibody, APC Conjugated
bs-21069R-APC 100 µL

P53 BP3 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Rabbit Anti Human MAP1LC3C Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 200ul
IRBAHUMAP1LC3CAP378200UL 200 µL

Rabbit Anti Human MAP1LC3C Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 200ul

Sign In for Pricing
View Details