Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-2 (TVB72)

This Recombinant Human T cell receptor beta variable 7-2 (TVB72) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-2 TRBV7-2

UniProt

A0A1B0GXF2

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPSNKVTEKGKDVELRCDPISGHTALYWYRQSLGQGLEFLIYFQGNSAPDKSGLPSDRFSAERTGGSVSTLTIQRTQQEDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EBP1 (C-11) Alexa Fluor® 488
sc-393114 AF488 200 µg/mL

EBP1 (C-11) Alexa Fluor® 488

Sign In for Pricing
View Details
MAGic Clamp™ magnetic clamp, 1000ml Erlenmeyer (max. 4)
H1000-MR-1000 1 Each

MAGic Clamp™ magnetic clamp, 1000ml Erlenmeyer (max. 4)

Sign In for Pricing
View Details
Spermine synthase Recombinant Antibody
bsm-62532R-TR 20 µL

Spermine synthase Recombinant Antibody

Sign In for Pricing
View Details
Biliverdin Reductase (BLVRA) (NM_000712) Human Over-expression Lysate
LS000644-20ug 20 µg

Biliverdin Reductase (BLVRA) (NM_000712) Human Over-expression Lysate

Sign In for Pricing
View Details
Human IL32 (Interleukin-32) QuickTest ELISA Kit
MBS7619242-01 48 Well

Human IL32 (Interleukin-32) QuickTest ELISA Kit

Sign In for Pricing
View Details
Human IL32 (Interleukin-32) QuickTest ELISA Kit
MBS7619242-02 96 Well

Human IL32 (Interleukin-32) QuickTest ELISA Kit

Sign In for Pricing
View Details