Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H2B type 2-K1 (H2BK1)

This Recombinant Human Histone H2B type 2-K1 (H2BK1) spans the amino acid sequence from region 2-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone H2B type 2-K1; Histone H2B type 2-E1; H2BK1 H2BE1

UniProt

A0A2R8Y619

Expression Region

2-122

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SAEYGQRQQPGGRGGRSSGNKKSKKRCRRKESYSMYIYKVLKQVHPDIGISAKAMSIMNSFVNDVFEQLACEAARLAQYSGRTTLTSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GZMA ELISA Kit (Mouse) (OKCD02583)
OKCD02583 96 Well

GZMA ELISA Kit (Mouse) (OKCD02583)

Sign In for Pricing
View Details
Innovative Grade US Origin Monkey Cynomolgus Whole Blood K2 EDTA 5ml
IGMNCYWBK2E5ML 5 mL

Innovative Grade US Origin Monkey Cynomolgus Whole Blood K2 EDTA 5ml

Sign In for Pricing
View Details
BAD Protein Vector (Human) (pPM-C-HA)
PV003439 500 ng

BAD Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Klk14 ORF Vector (Mouse) (pORF)
ORF048699 1.0 µg DNA

Klk14 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
BAY-1436032
BA7848-5 5 mg

BAY-1436032

Sign In for Pricing
View Details
PHAF1 (NM_025187) Human Over-expression Lysate
LS080262-100ug 100 µg

PHAF1 (NM_025187) Human Over-expression Lysate

Sign In for Pricing
View Details