Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-specific Y-encoded protein 9 (TSPY9)

This Recombinant Human Testis-specific Y-encoded protein 9 (TSPY9) spans the amino acid sequence from region 1-314. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-specific Y-encoded protein 9 TSPY9 TSPY9P

UniProt

A0A494C1R9

Expression Region

1-314

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDIMAEVEVVAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESALEELLAVQVELEPVNAQARKAFSRQREKMERRRKPQLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVEEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDLWRNPLQYYKRMKPPEEGTETSGDSQLLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human 5-NT (5-Nucleotidase) CLIA Kit
E-CL-H0198-01 24 Tests

Human 5-NT (5-Nucleotidase) CLIA Kit

Sign In for Pricing
View Details
Human 5-NT (5-Nucleotidase) CLIA Kit
E-CL-H0198-02 48 Tests

Human 5-NT (5-Nucleotidase) CLIA Kit

Sign In for Pricing
View Details
Human 5-NT (5-Nucleotidase) CLIA Kit
E-CL-H0198-03 96 Tests

Human 5-NT (5-Nucleotidase) CLIA Kit

Sign In for Pricing
View Details
CD80 (B7-1) (C80/2725), CF405S conjugate, 0.1mg/mL
BNC042725-100 1x 100 µL

CD80 (B7-1) (C80/2725), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/3350), 1mg/mL
BNUM3350-50 1x 50 µL

NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/3350), 1mg/mL

Sign In for Pricing
View Details
CYSLTR1 Antibody
8G074-AAT 50 µg

CYSLTR1 Antibody

Sign In for Pricing
View Details