Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 3-1 (TVB31)

This Recombinant Human T cell receptor beta variable 3-1 (TVB31) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 3-1 TRBV3-1 TCRBV9S1A1T

UniProt

A0A576

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AVSQTPKYLVTQMGNDKSIKCEQNLGHDTMYWYKQDSKKFLKIMFSYNNKELIINETVPNRFSPKSPDKAHLNLHINSLELGDSAVYFCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Sephs2 shRNA (UAS) - Lentiviral mouse Sephs2 shRNA (UAS, RFP) (25)
GTR15241451 1 Vial

Lentiviral mouse Sephs2 shRNA (UAS) - Lentiviral mouse Sephs2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Mouse anti-Desmin Antibody
DL99544A-01 50 µL

Mouse anti-Desmin Antibody

Sign In for Pricing
View Details
Mouse anti-Desmin Antibody
DL99544A-02 100 µL

Mouse anti-Desmin Antibody

Sign In for Pricing
View Details
INDO (IDO, Indoleamine 2,3-dioxygenase 1, IDO-1, Indoleamine-pyrrole 2,3-dioxygenase, IDO1)
I7545-09 100 µg

INDO (IDO, Indoleamine 2,3-dioxygenase 1, IDO-1, Indoleamine-pyrrole 2,3-dioxygenase, IDO1)

Sign In for Pricing
View Details
Tor1a (NM_153303) Rat Untagged Clone
RN214924 10 µg

Tor1a (NM_153303) Rat Untagged Clone

Sign In for Pricing
View Details
m-CPP hydrochloride
B5027-50 50 mg

m-CPP hydrochloride

Sign In for Pricing
View Details