Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 4-1 (TVB41)

This Recombinant Human T cell receptor beta variable 4-1 (TVB41) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 4-1 TRBV4-1 TCRBV7S1A1N2T

UniProt

A0A577

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVTQTPKHLVMGMTNKKSLKCEQHMGHRAMYWYKQKAKKPPELMFVYSYEKLSINESVPSRFSPECPNSSLLNLHLHALQPEDSALYLCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

α-synuclein aggregate Antibody [C4F17]
C19766-100uL 100 µL

α-synuclein aggregate Antibody [C4F17]

Sign In for Pricing
View Details
Anti-ATR Antibody , Dylight550 Conjugate
A00262-2-Dylight550 100 µg

Anti-ATR Antibody , Dylight550 Conjugate

Sign In for Pricing
View Details
C1orf158 Rabbit Polyclonal Antibody (Cy5.5)
orb1062908 100 µL

C1orf158 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
1-Hexanol
158481 10 mL

1-Hexanol

Sign In for Pricing
View Details
Ixekizumab Biosimilar - Research Grade
ICH5165-200mg 200 mg

Ixekizumab Biosimilar - Research Grade

Sign In for Pricing
View Details
CAMKV Protein Lysate (Human) with C-Ha Tag
14967031 100 µg

CAMKV Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details