Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 4-1 (TVB41)

This Recombinant Human T cell receptor beta variable 4-1 (TVB41) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 4-1 TRBV4-1 TCRBV7S1A1N2T

UniProt

A0A577

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVTQTPKHLVMGMTNKKSLKCEQHMGHRAMYWYKQKAKKPPELMFVYSYEKLSINESVPSRFSPECPNSSLLNLHLHALQPEDSALYLCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITGB1 Recombinant Protein (Rat)
RP206375 100 µg

ITGB1 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Rabbit Monoclonal S100A7/Psoriasin Antibody (129) [FITC]
NBP2-89814F 0.1 mL

Rabbit Monoclonal S100A7/Psoriasin Antibody (129) [FITC]

Sign In for Pricing
View Details
CD144/VE Cadherin Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-61376R-BF594-TR 20 µL

CD144/VE Cadherin Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
RHOT2 Peptide
DF12721-BP 1 mg

RHOT2 Peptide

Sign In for Pricing
View Details
KLF12 (AP2REP, Krueppel-like Factor 12, Transcriptional Repressor AP-2rep, HSPC122) APC
MBS6137307-01 0.1 mL

KLF12 (AP2REP, Krueppel-like Factor 12, Transcriptional Repressor AP-2rep, HSPC122) APC

Sign In for Pricing
View Details
KLF12 (AP2REP, Krueppel-like Factor 12, Transcriptional Repressor AP-2rep, HSPC122) APC
MBS6137307-02 5x 0.1 mL

KLF12 (AP2REP, Krueppel-like Factor 12, Transcriptional Repressor AP-2rep, HSPC122) APC

Sign In for Pricing
View Details