Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 5-1 (TVB51)

This Recombinant Human T cell receptor beta variable 5-1 (TVB51) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 5-1 TRBV5-1 TCRBV5S1A1T

UniProt

A0A578

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPRYLIKTRGQQVTLSCSPISGHRSVSWYQQTPGQGLQFLFEYFSETQRNKGNFPGRFSGRQFSNSRSEMNVSTLELGDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOSTRIN (Nitric Oxide Synthase Trafficker, DaIP2) (MaxLight 405)
MBS6429405-01 0.1 mL

NOSTRIN (Nitric Oxide Synthase Trafficker, DaIP2) (MaxLight 405)

Sign In for Pricing
View Details
NOSTRIN (Nitric Oxide Synthase Trafficker, DaIP2) (MaxLight 405)
MBS6429405-02 5x 0.1 mL

NOSTRIN (Nitric Oxide Synthase Trafficker, DaIP2) (MaxLight 405)

Sign In for Pricing
View Details
Acetyl-Histone H2B(K20) Antibody Cy5 Conjugated
C04920Cy5 100 µL

Acetyl-Histone H2B(K20) Antibody Cy5 Conjugated

Sign In for Pricing
View Details
CELLMASTER roller bottle, TC, 5XL, 4640ml, 4250cm2, 500x122mm, polystyrene, graduation 100-1000ml, blue screw cap, subpacked per piece, STERILE, 12 pieces per CAR
682670 12 pieces per CAR

CELLMASTER roller bottle, TC, 5XL, 4640ml, 4250cm2, 500x122mm, polystyrene, graduation 100-1000ml, blue screw cap, subpacked per piece, STERILE, 12 pieces per CAR

Sign In for Pricing
View Details
Human IFT46 activation kit by CRISPRa
GA111263 1 Kit

Human IFT46 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Shigella boydii serotype 4 Shikimate kinase 1 (aroK)
MBS1379422-01 0.02 mg (E-Coli)

Recombinant Shigella boydii serotype 4 Shikimate kinase 1 (aroK)

Sign In for Pricing
View Details