Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 11-2 (TVBK2)

This Recombinant Human T cell receptor beta variable 11-2 (TVBK2) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 11-2 TRBV11-2 TCRBV21S3A2N2T

UniProt

A0A584

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVAQSPRYKIIEKRQSVAFWCNPISGHATLYWYQQILGQGPKLLIQFQNNGVVDDSQLPKDRFSAERLKGVDSTLKIQPAKLEDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Coprophilin
BIBR1032 1 Each

Coprophilin

Sign In for Pricing
View Details
Ipcef1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
25025116 3x 1.0 µg

Ipcef1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Zfp583 Peptide - middle region
MBS3235036-01 0.1 mg

Zfp583 Peptide - middle region

Sign In for Pricing
View Details
Zfp583 Peptide - middle region
MBS3235036-02 5x 0.1 mg

Zfp583 Peptide - middle region

Sign In for Pricing
View Details
Anti-DDX6 Antibody (FITC)
STJ500746 100 µg

Anti-DDX6 Antibody (FITC)

Sign In for Pricing
View Details
RBBP8 Antibody
A40218-100UG 100 µg

RBBP8 Antibody

Sign In for Pricing
View Details