Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 11-2 (TVBK2)

This Recombinant Human T cell receptor beta variable 11-2 (TVBK2) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 11-2 TRBV11-2 TCRBV21S3A2N2T

UniProt

A0A584

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVAQSPRYKIIEKRQSVAFWCNPISGHATLYWYQQILGQGPKLLIQFQNNGVVDDSQLPKDRFSAERLKGVDSTLKIQPAKLEDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Psg16 (NM_001025679) Rat Tagged ORF Clone Lentiviral Particle
RR214658L3V 200 µL

Psg16 (NM_001025679) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PA1 (PAGR1) Human siRNA Oligo Duplex (Locus ID 79447)
SR312423 1 Kit

PA1 (PAGR1) Human siRNA Oligo Duplex (Locus ID 79447)

Sign In for Pricing
View Details
Slc16a9 Mouse shRNA Plasmid (Locus ID 66859)
TR503745 1 Kit

Slc16a9 Mouse shRNA Plasmid (Locus ID 66859)

Sign In for Pricing
View Details
Nup160 Mouse shRNA Plasmid (Locus ID 59015)
TL514597 1 Kit

Nup160 Mouse shRNA Plasmid (Locus ID 59015)

Sign In for Pricing
View Details
Corneodesmosin (CDSN, S Protein) (MaxLight 650)
125236-ML650 100 µL

Corneodesmosin (CDSN, S Protein) (MaxLight 650)

Sign In for Pricing
View Details
(2-Chloro-4-isopropoxyphenyl) boronic acid
OR350084 250 mg

(2-Chloro-4-isopropoxyphenyl) boronic acid

Sign In for Pricing
View Details