Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 4-3 (TVB43)

This Recombinant Human T cell receptor beta variable 4-3 (TVB43) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 4-3 TRBV4-3 TCRBV7S2A1N4T

UniProt

A0A589

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQSAKKPLELMFVYSLEERVENNSVPSRFSPECPNSSHLFLHLHTLQPEDSALYLCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA Human Toll Like Receptor 9 (TLR-9 / TLR9) ELISA
KBH16879 1x 96 Well

GENLISA Human Toll Like Receptor 9 (TLR-9 / TLR9) ELISA

Sign In for Pricing
View Details
Recombinant Human ATPAF2 Protein, His, E.coli-200ug
QP5700-ec-200ug 200ug

Recombinant Human ATPAF2 Protein, His, E.coli-200ug

Sign In for Pricing
View Details
GAL3ST4 Rabbit Polyclonal Antibody (Center)
E28PB1112 100 µL

GAL3ST4 Rabbit Polyclonal Antibody (Center)

Sign In for Pricing
View Details
Zgpat Rat siRNA Oligo Duplex (Locus ID 296478)
SR503245 1 Kit

Zgpat Rat siRNA Oligo Duplex (Locus ID 296478)

Sign In for Pricing
View Details
JNK1 + JNK3 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb1587191 100 µL

JNK1 + JNK3 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
LY-338979
OR1075410 1 Each

LY-338979

Sign In for Pricing
View Details