Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 45 (SMI45), partial

This Recombinant Human Small integral membrane protein 45 (SMI45), partial spans the amino acid sequence from region 28-68. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 45 SMIM45 LINC00634

UniProt

A0A590UK83

Expression Region

28-68

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YYFEPGLQEAHKWRMQRPLVDRDLRKTLMVRDNLAFGGPEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ISO20560PM-180X1700-TOLUEEN Pipe Markers for Other Liquids
317605 1 Pack (1 Marker (s) x 1 Card)

ISO20560PM-180X1700-TOLUEEN Pipe Markers for Other Liquids

Sign In for Pricing
View Details
Lentiviral mouse Slc39a9 shRNA (UAS) - Lentiviral mouse Slc39a9 shRNA (UAS, GFP) (100)
GTR15302652 1 Vial

Lentiviral mouse Slc39a9 shRNA (UAS) - Lentiviral mouse Slc39a9 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Semicircular Blocks, Glass
1110420/A2 1 Each

Semicircular Blocks, Glass

Sign In for Pricing
View Details
C5orf36 Double Nickase Plasmid (h)
sc-415431-NIC 20 µg

C5orf36 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Bone sialoprotein 2
AP78800-01 50 µg

Bone sialoprotein 2

Sign In for Pricing
View Details
Bone sialoprotein 2
AP78800-02 100 µg

Bone sialoprotein 2

Sign In for Pricing
View Details