Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 45 (SMI45), partial

This Recombinant Human Small integral membrane protein 45 (SMI45), partial spans the amino acid sequence from region 28-68. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 45 SMIM45 LINC00634

UniProt

A0A590UK83

Expression Region

28-68

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YYFEPGLQEAHKWRMQRPLVDRDLRKTLMVRDNLAFGGPEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SLC24A2 Antibody
NBP3-05674-20ul 20 µL

Rabbit Polyclonal SLC24A2 Antibody

Sign In for Pricing
View Details
KCNK13 (NM_022054) Human Over-expression Lysate
LS056659 100 µg

KCNK13 (NM_022054) Human Over-expression Lysate

Sign In for Pricing
View Details
ZNF211 antibody
FNab09667 100 µg

ZNF211 antibody

Sign In for Pricing
View Details
Cend1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7224607 1.0 µg DNA

Cend1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Human Recombinant CKMM
P1610-50 50 µg

Human Recombinant CKMM

Sign In for Pricing
View Details
Rabbit Anti-Influenza B virus Ig's ELISA kit, 96 tests, Quantitative
920-600-RBG 1 Kit

Rabbit Anti-Influenza B virus Ig's ELISA kit, 96 tests, Quantitative

Sign In for Pricing
View Details