Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 5-8 (TVB58)

This Recombinant Human T cell receptor beta variable 5-8 (TVB58) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 5-8 TRBV5-8 TCRBV5S4A2T

UniProt

A0A5A2

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQATLRCSPISGHTSVYWYQQALGLGLQFLLWYDEGEERNRGNFPPRFSGRQFPNYSSELNVNALELEDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF125 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-9250R-BF350 100 µL

RNF125 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
TNF-alpha APC1, Cachectin, Differentiation inducing factor (DIF), Macrophage cytotoxic factor (MCF), Necrosin, TNF alpha, TNF Macrophage Derived, TNF Monocyte Derived, TNF Superfamily Member 2, TNFA, TNFSF2, Tumor necrosis factor ligand superfamily member 2, Tumor Necrosis Factor Precursor (AP) discontinued
168883-AF-AP 100 µL

TNF-alpha APC1, Cachectin, Differentiation inducing factor (DIF), Macrophage cytotoxic factor (MCF), Necrosin, TNF alpha, TNF Macrophage Derived, TNF Monocyte Derived, TNF Superfamily Member 2, TNFA, TNFSF2, Tumor necrosis factor ligand superfamily member 2, Tumor Necrosis Factor Precursor (AP) discontinued

Sign In for Pricing
View Details
Mmu-miR-374b-3p miRNA Agomir
CMN0328-01 5 nmol

Mmu-miR-374b-3p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-374b-3p miRNA Agomir
CMN0328-02 10 nmol

Mmu-miR-374b-3p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-374b-3p miRNA Agomir
CMN0328-03 20 nmol

Mmu-miR-374b-3p miRNA Agomir

Sign In for Pricing
View Details
TWSG1 CRISPRa sgRNA lentivector (set of three targets)(Rat)
48859126 3x 1.0µg DNA

TWSG1 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details