Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 14 (TVB14)

This Recombinant Human T cell receptor beta variable 14 (TVB14) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 14 TRBV14 TCRBV14S1 TCRBV16S1A1N1

UniProt

A0A5B0

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQFPSHSVIEKGQTVTLRCDPISGHDNLYWYRRVMGKEIKFLLHFVKESKQDESGMPNNRFLAERTGGTYSTLKVQPAELEDSGVYFCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PacBlue Anti-human CD11a Antibody *HI111*
101101J0-AAT 100 Tests

PacBlue Anti-human CD11a Antibody *HI111*

Sign In for Pricing
View Details
CLDN5 Protein Lysate (Human) with C-Ha Tag
16285031 100 µg

CLDN5 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
CD21 Monoclonal Antibody (2C5)
E44H10710 100 µL

CD21 Monoclonal Antibody (2C5)

Sign In for Pricing
View Details
Rhox2f sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3068706 1.0 µg DNA

Rhox2f sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
6-Phospho-D-Gluconate (6PG)
MBS682166 100 mg

6-Phospho-D-Gluconate (6PG)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Numb Homolog (NUMB)
MBS2081935-01 0.1 mL

HRP-Linked Polyclonal Antibody to Numb Homolog (NUMB)

Sign In for Pricing
View Details