Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 28 (TVB28)

This Recombinant Human T cell receptor beta variable 28 (TVB28) spans the amino acid sequence from region 27-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 28 TRBV28 TCRBV3S1

UniProt

A0A5B6

Expression Region

27-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SRYLVKRTGEKVFLECVQDMDHENMFWYRQDPGLGLRLIYFSYDVKMKEKGDIPEGYSVSREKKERFSLILESASTNQTSMYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TEKT1, ID (TEKT1, Tektin-1) (MaxLight 650) discontinued
042732-ML650 100 µL

TEKT1, ID (TEKT1, Tektin-1) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Grpel2 shRNA (UAS) - Lentiviral mouse Grpel2 shRNA (UAS) (25)
GTR15268301 1 Vial

Lentiviral mouse Grpel2 shRNA (UAS) - Lentiviral mouse Grpel2 shRNA (UAS) (25)

Sign In for Pricing
View Details
HNF4α/γ (K127) polyclonal antibody
orb643268-01 25 µL

HNF4α/γ (K127) polyclonal antibody

Sign In for Pricing
View Details
HNF4α/γ (K127) polyclonal antibody
orb643268-02 50 μL

HNF4α/γ (K127) polyclonal antibody

Sign In for Pricing
View Details
HNF4α/γ (K127) polyclonal antibody
orb643268-03 100 µL

HNF4α/γ (K127) polyclonal antibody

Sign In for Pricing
View Details
HNF4α/γ (K127) polyclonal antibody
orb643268-04 200 µL

HNF4α/γ (K127) polyclonal antibody

Sign In for Pricing
View Details