Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 29-1 (TVB29)

This Recombinant Human T cell receptor beta variable 29-1 (TVB29) spans the amino acid sequence from region 17-111. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 29-1 TRBV29-1 TCRBV4S1A1T

UniProt

A0A5B7

Expression Region

17-111

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AVISQKPSRDICQRGTSLTIQCQVDSQVTMMFWYRQQPGQSLTLIATANQGSEATYESGFVIDKFPISRPNLTFSTLTVSNMSPEDSSIYLCSVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOB1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4H3]
TA808806AM 100 µL

NOB1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4H3]

Sign In for Pricing
View Details
C8orf86 (NM_207412) Human Over-expression Lysate
LY404018 100 µg

C8orf86 (NM_207412) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Mouse MEK1/MAP2K1/MKK1 Protein (His & GST Tag)
PKSM040747 50 µg

Recombinant Mouse MEK1/MAP2K1/MKK1 Protein (His & GST Tag)

Sign In for Pricing
View Details
Loratadine-d4 Epoxide N-Oxide
TRC-L469592-1MG 1 mg

Loratadine-d4 Epoxide N-Oxide

Sign In for Pricing
View Details
Tex46 (NM_026300) Mouse Tagged ORF Clone
MG201321 10 µg

Tex46 (NM_026300) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
beta B1 Crystallin (CRYBB1) (NM_001887) Human Recombinant Protein
TP307718 20 µg

beta B1 Crystallin (CRYBB1) (NM_001887) Human Recombinant Protein

Sign In for Pricing
View Details