Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 29-1 (TVB29)

This Recombinant Human T cell receptor beta variable 29-1 (TVB29) spans the amino acid sequence from region 17-111. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 29-1 TRBV29-1 TCRBV4S1A1T

UniProt

A0A5B7

Expression Region

17-111

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AVISQKPSRDICQRGTSLTIQCQVDSQVTMMFWYRQQPGQSLTLIATANQGSEATYESGFVIDKFPISRPNLTFSTLTVSNMSPEDSSIYLCSVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit MARCKS
P40017-100 100 µL

Rabbit MARCKS

Sign In for Pricing
View Details
PDE7A Polyclonal Antibody
E-AB-91039-01 60 µL

PDE7A Polyclonal Antibody

Sign In for Pricing
View Details
PDE7A Polyclonal Antibody
E-AB-91039-02 120 µL

PDE7A Polyclonal Antibody

Sign In for Pricing
View Details
PDE7A Polyclonal Antibody
E-AB-91039-03 200 µL

PDE7A Polyclonal Antibody

Sign In for Pricing
View Details
Pi-Methylimidazoleacetic acid hydrochloride 2mg
A21732-2 2 mg

Pi-Methylimidazoleacetic acid hydrochloride 2mg

Sign In for Pricing
View Details
Gpat3 (NM_172715) Mouse Untagged Clone
MC215874 10 µg

Gpat3 (NM_172715) Mouse Untagged Clone

Sign In for Pricing
View Details