Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 38-2/delta variable 8 (TV382)

This Recombinant Human T cell receptor alpha variable 38-2/delta variable 8 (TV382) spans the amino acid sequence from region 22-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 38-2/delta variable 8 TRAV38-2DV8

UniProt

A0JD32

Expression Region

22-116

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QTVTQSQPEMSVQEAETVTLSCTYDTSESDYYLFWYKQPPSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAYRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Loxl2 3'UTR Luciferase Stable Cell Line
TU112526 1.0 mL

Loxl2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
GEN1 Rabbit pAb, AE conjugated
orb2884745 100 µL

GEN1 Rabbit pAb, AE conjugated

Sign In for Pricing
View Details
Mouse Monoclonal anti-human Cystatin-S
hAP-0232 100 µg

Mouse Monoclonal anti-human Cystatin-S

Sign In for Pricing
View Details
TTI2 Antibody - N-terminal region
MBS3217704-01 0.1 mL

TTI2 Antibody - N-terminal region

Sign In for Pricing
View Details
TTI2 Antibody - N-terminal region
MBS3217704-02 5x 0.1 mL

TTI2 Antibody - N-terminal region

Sign In for Pricing
View Details
Clca4a (NM_207208) Mouse Tagged ORF Clone
MR217842 10 µg

Clca4a (NM_207208) Mouse Tagged ORF Clone

Sign In for Pricing
View Details