Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor delta variable 3 (TRDV3)

This Recombinant Human T cell receptor delta variable 3 (TRDV3) spans the amino acid sequence from region 19-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor delta variable 3 TRDV3 hDV103S1

UniProt

A0JD37

Expression Region

19-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DKVTQSSPDQTVASGSEVVLLCTYDTVYSNPDLFWYRIRPDYSFQFVFYGDNSRSEGADFTQGRFSVKHILTQKAFHLVISPVRTEDSATYYCAF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIRC9 ORF Vector (Human) (pORF)
ORF027881 1.0 µg DNA

PIRC9 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
NPVF/RFRP Rabbit Polyclonal Antibody (BF405)
orb2470539 100 µL

NPVF/RFRP Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Recombinant Human ERVK-8 Protein (C-His)
BP2500-50ug 50 µg

Recombinant Human ERVK-8 Protein (C-His)

Sign In for Pricing
View Details
Dusp19 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3258904 1.0 µg DNA

Dusp19 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Trans-4- (6,8-Dibromo-3 (4H) -quinazolinyl) cyclohexanol hydrochloride
ID183211-01 25 mg

Trans-4- (6,8-Dibromo-3 (4H) -quinazolinyl) cyclohexanol hydrochloride

Sign In for Pricing
View Details
Trans-4- (6,8-Dibromo-3 (4H) -quinazolinyl) cyclohexanol hydrochloride
ID183211-02 50 mg

Trans-4- (6,8-Dibromo-3 (4H) -quinazolinyl) cyclohexanol hydrochloride

Sign In for Pricing
View Details