Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor delta variable 3 (TRDV3)

This Recombinant Human T cell receptor delta variable 3 (TRDV3) spans the amino acid sequence from region 19-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor delta variable 3 TRDV3 hDV103S1

UniProt

A0JD37

Expression Region

19-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DKVTQSSPDQTVASGSEVVLLCTYDTVYSNPDLFWYRIRPDYSFQFVFYGDNSRSEGADFTQGRFSVKHILTQKAFHLVISPVRTEDSATYYCAF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human COA7 knockdown cell line
ABC-KD3356 1 Vial

Human COA7 knockdown cell line

Sign In for Pricing
View Details
ZNF207 Antibody, Biotin conjugated
A38785-50UG 50 µg

ZNF207 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Fam70a AAV siRNA Pooled Vector
20089166 1.0 µg

Fam70a AAV siRNA Pooled Vector

Sign In for Pricing
View Details
ZNF117 Protein Lysate (Human) with C-Ha Tag
51297031 100 µg

ZNF117 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Cadherin, Epithelial (CDHE) BioAssayTM ELISA Kit (Chicken) discontinued
023833-01 48 Tests

Cadherin, Epithelial (CDHE) BioAssayTM ELISA Kit (Chicken) discontinued

Sign In for Pricing
View Details
Cadherin, Epithelial (CDHE) BioAssayTM ELISA Kit (Chicken) discontinued
023833-02 96 Tests

Cadherin, Epithelial (CDHE) BioAssayTM ELISA Kit (Chicken) discontinued

Sign In for Pricing
View Details