Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein SHMOOSE (SHMOS)

This Recombinant Human Protein SHMOOSE (SHMOS) spans the amino acid sequence from region 1-58. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein SHMOOSE; Small human mitochondrial ORF over serine tRNA

UniProt

C0HM83

Expression Region

1-58

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPPCLTTWLSQLLKDNSYPLVLGPKNFGATPNKSNNHAHYYNHPNPDFPNSPHPYHPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Rasgrp2 activation kit by CRISPRa
GA203566 1 Kit

Mouse Rasgrp2 activation kit by CRISPRa

Sign In for Pricing
View Details
GFP Mouse Monoclonal Antibody [Clone ID: AT2G5]
AM09077PU-S 50 µL

GFP Mouse Monoclonal Antibody [Clone ID: AT2G5]

Sign In for Pricing
View Details
Foxk2 Rabbit Polyclonal Antibody
ER2001-47 100 µL

Foxk2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD4 (C4/206), CF568 conjugate, 0.1mg/mL
BNC680206-100 1x 100 µL

CD4 (C4/206), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD1a (O10), CF405S conjugate, 0.1mg/mL
BNC040667-500 1x 500 µL

CD1a (O10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Allocholic Acid
TRC-A545000-50MG 50 mg

Allocholic Acid

Sign In for Pricing
View Details