Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein SHMOOSE (SHMOS)

This Recombinant Human Protein SHMOOSE (SHMOS) spans the amino acid sequence from region 1-58. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein SHMOOSE; Small human mitochondrial ORF over serine tRNA

UniProt

C0HM83

Expression Region

1-58

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPPCLTTWLSQLLKDNSYPLVLGPKNFGATPNKSNNHAHYYNHPNPDFPNSPHPYHPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Homoserine
TRC-H615010-250MG 250 mg

L-Homoserine

Sign In for Pricing
View Details
Cytokeratin 6 (LHK6), CF740 conjugate, 0.1mg/mL
BNC740675-100 1x 100 µL

Cytokeratin 6 (LHK6), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (HP6053), CF555 conjugate, 0.1mg/mL
BNC550681-100 1x 100 µL

Human Kappa Light Chain (HP6053), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Epsin 2 (EPN2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F1]
TA504298BM 100 µL

Epsin 2 (EPN2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F1]

Sign In for Pricing
View Details
EB2 (MAPRE2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C7]
TA502960AM 100 µL

EB2 (MAPRE2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C7]

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Herpes Simplex II,  5nm
GM-16-5 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Herpes Simplex II, 5nm

Sign In for Pricing
View Details