Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein SHMOOSE (SHMOS)

This Recombinant Human Protein SHMOOSE (SHMOS) spans the amino acid sequence from region 1-58. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein SHMOOSE; Small human mitochondrial ORF over serine tRNA

UniProt

C0HM83

Expression Region

1-58

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPPCLTTWLSQLLKDNSYPLVLGPKNFGATPNKSNNHAHYYNHPNPDFPNSPHPYHPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vom2r47 (NM_001099506) Rat Tagged ORF Clone Lentiviral Particle
RR214910L4V 200 µL

Vom2r47 (NM_001099506) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-MAP2
G147 100 µg

Anti-MAP2

Sign In for Pricing
View Details
ZNF586 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2717507 1.0 µg DNA

ZNF586 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
OST-beta Polyclonal Antibody, PerCP Conjugated
bs-2128R-PerCP 100 µL

OST-beta Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Vericiguat Amide Impurity
CS-O-56586 1 Each

Vericiguat Amide Impurity

Sign In for Pricing
View Details
Anti-UBE2M Mouse Monoclonal Antibody [Clone ID: OTI2D9]
M07478 100 µL

Anti-UBE2M Mouse Monoclonal Antibody [Clone ID: OTI2D9]

Sign In for Pricing
View Details