Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein SHMOOSE (SHMOS)

This Recombinant Human Protein SHMOOSE (SHMOS) spans the amino acid sequence from region 1-58. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein SHMOOSE; Small human mitochondrial ORF over serine tRNA

UniProt

C0HM83

Expression Region

1-58

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPPCLTTWLSQLLKDNSYPLVLGPKNFGATPNKSNNHAHYYNHPNPDFPNSPHPYHPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CLEC1B (NM_001099431) AAV Particle
RC217343A1V 250 µL

Human CLEC1B (NM_001099431) AAV Particle

Sign In for Pricing
View Details
Goat Cerberus (CER1) ELISA Kit
GTR10349495 96 Well

Goat Cerberus (CER1) ELISA Kit

Sign In for Pricing
View Details
Pik3r1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
36685116 3x 1.0 µg

Pik3r1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Flt3l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4728807 1.0 µg DNA

Flt3l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
COQ8A Polyclonal Antibody, PE-Cy5 Conjugated
bs-8071R-PE-Cy5 100 µL

COQ8A Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
FAM111A Antibody
CSB-PA853484LA01HU-01 50 µg

FAM111A Antibody

Sign In for Pricing
View Details