Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative dispanin subfamily A member 2d (DSA2D), partial

This Recombinant Human Putative dispanin subfamily A member 2d (DSA2D), partial spans the amino acid sequence from region 1-57. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative dispanin subfamily A member 2d; DSPA2d

UniProt

C9JQL5

Expression Region

1-57

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNHTVQTFFSPVNSGQPPNYEMLKEEHKVAVLGVPHNPAPPTSTVIHIRSKTSVPHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL
BNC680460-100 1x 100 µL

CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL
BNC680806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL
BNC740009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL
BNC400270-500 1x 500 µL

Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL
BNC040391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Retinol Binding Protein-1 (G4E4), CF488A conjugate, 0.1mg/mL
BNC880855-100 1x 100 µL

Retinol Binding Protein-1 (G4E4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details