Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ret finger protein-like 4A-like protein 1 (RFAL1)

This Recombinant Human Ret finger protein-like 4A-like protein 1 (RFAL1) spans the amino acid sequence from region 1-287. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ret finger protein-like 4A-like protein 1 RFPL4AL1

UniProt

F8VTS6

Expression Region

1-287

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAEHFKQIIRCPVCLKDLEEAVQLKCGYACCLQCLNSLQKEPDGEGLLCRFCSVVSQKDDIKPKYKLRALVSIIKELEPKLKSVLTMNPRMRKFQVDMTFDVDTANNYLIISEDLRSFRSGDLSQNRKEQAERFDTALCVLGTPRFTSGRHYWEVDVGTSQVWDVGVCKESVNRQGKIELSSEHGFLTVGCREGKVFAASTVPMTPLWVSPQLHRVGIFLDVGMRSIAFYNVSDGCHINTFIEIPVCEPWRPFFAHKRGSQDDQSILSICSVINPSTASAPVSSEGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Cytokeratin 15 Antibody Clone LHK15, Unconjugated-20ug
3866-MSM1-P0 20ug

Anti-Cytokeratin 15 Antibody Clone LHK15, Unconjugated-20ug

Sign In for Pricing
View Details
RPL31P39 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV779704 1.0 µg DNA

RPL31P39 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Recombinant Human Docking protein 1
MBS1368368-01 0.02 mg (Yeast)

Recombinant Human Docking protein 1

Sign In for Pricing
View Details
Recombinant Human Docking protein 1
MBS1368368-02 0.1 mg (Yeast)

Recombinant Human Docking protein 1

Sign In for Pricing
View Details
Recombinant Human Docking protein 1
MBS1368368-03 1 mg (Yeast)

Recombinant Human Docking protein 1

Sign In for Pricing
View Details
Recombinant Human Docking protein 1
MBS1368368-04 5x 1 mg (Yeast)

Recombinant Human Docking protein 1

Sign In for Pricing
View Details