Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ASNSD1 upstream open reading frame protein (ASURF)

This Recombinant Human ASNSD1 upstream open reading frame protein (ASURF) spans the amino acid sequence from region 1-96. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ASNSD1 upstream open reading frame protein; ASNSD1 small/short open reading frame-encoded polypeptide; ASNSD1-SEP; ASDURF

UniProt

L0R819

Expression Region

1-96

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPSRGTRPEDSSVLIPTDNSTPHKEDLSSKIKEQKIVVDELSNLKKNRKVYRQQQNSNIFFLADRTEMLSESKNILDELKKEYQEIENLDKTKIKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amd2 Mouse Gene Knockout Kit (CRISPR)
KN501183 1 Kit

Amd2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
KISS1 Rabbit pAb (APR25057N)
APR25057N-01 50 µL

KISS1 Rabbit pAb (APR25057N)

Sign In for Pricing
View Details
KISS1 Rabbit pAb (APR25057N)
APR25057N-02 100 µL

KISS1 Rabbit pAb (APR25057N)

Sign In for Pricing
View Details
KISS1 Rabbit pAb (APR25057N)
APR25057N-03 200 µL

KISS1 Rabbit pAb (APR25057N)

Sign In for Pricing
View Details
Canine WD repeat containing protein 48 (WDR48) ELISA Kit
GTR10348998 96 Well

Canine WD repeat containing protein 48 (WDR48) ELISA Kit

Sign In for Pricing
View Details
Complete Medium for Rabbit Lens Epithelial Cells
abx704638-01 100 mL

Complete Medium for Rabbit Lens Epithelial Cells

Sign In for Pricing
View Details