Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ASNSD1 upstream open reading frame protein (ASURF)

This Recombinant Human ASNSD1 upstream open reading frame protein (ASURF) spans the amino acid sequence from region 1-96. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ASNSD1 upstream open reading frame protein; ASNSD1 small/short open reading frame-encoded polypeptide; ASNSD1-SEP; ASDURF

UniProt

L0R819

Expression Region

1-96

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPSRGTRPEDSSVLIPTDNSTPHKEDLSSKIKEQKIVVDELSNLKKNRKVYRQQQNSNIFFLADRTEMLSESKNILDELKKEYQEIENLDKTKIKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zebrafish Adamts1 Rabbit Polyclonal Antibody (Cy3)
orb2572364 200 µL

Zebrafish Adamts1 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
D8-MMAE 5mg
A21709-5 5 mg

D8-MMAE 5mg

Sign In for Pricing
View Details
Recombinant Porphyra purpurea Photosystem II reaction center protein Z (psbZ), partial
MBS7061250 Inquire

Recombinant Porphyra purpurea Photosystem II reaction center protein Z (psbZ), partial

Sign In for Pricing
View Details
AGTPBP1 Protein Vector (Mouse) (pPM-C-His)
PV153125 500 ng

AGTPBP1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Zap-70 Antibody [E5E23]
C21191-50uL 50 μL

Zap-70 Antibody [E5E23]

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to CCAAT/Enhancer Binding Protein Alpha (CEBPa)
MBS2145150-01 0.1 mL

Biotin-Linked Monoclonal Antibody to CCAAT/Enhancer Binding Protein Alpha (CEBPa)

Sign In for Pricing
View Details