Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial pyruvate carrier 1-like protein (MPC1L), partial

This Recombinant Human Mitochondrial pyruvate carrier 1-like protein (MPC1L), partial spans the amino acid sequence from region 75-136. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mitochondrial pyruvate carrier 1-like protein MPC1L

UniProt

P0DKB6

Expression Region

75-136

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VQPRNLLLMACHCTNVMAQSVQASRYLLYYYGGGGAEAKARDPPATAAAATSPGSQPPKQAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFNL2 Antibody
CSB-PA005422-01 50 µg

IFNL2 Antibody

Sign In for Pricing
View Details
IFNL2 Antibody
CSB-PA005422-02 100 µg

IFNL2 Antibody

Sign In for Pricing
View Details
Chuk (NM_001107588) Rat Tagged ORF Clone Lentiviral Particle
RR203015L4V 200 µL

Chuk (NM_001107588) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
AChRβ1 (148) Alexa Fluor® 594
sc-65813 AF594 200 µg/mL

AChRβ1 (148) Alexa Fluor® 594

Sign In for Pricing
View Details
ACOT1 (NM_001037161) Human Recombinant Protein
TP321302 20 µg

ACOT1 (NM_001037161) Human Recombinant Protein

Sign In for Pricing
View Details
Canine Actinin Alpha 2 ELISA Kit
MBS735801-01 48 Well

Canine Actinin Alpha 2 ELISA Kit

Sign In for Pricing
View Details